PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015899981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NF-YB
Protein Properties Length: 137aa    MW: 15347.4 Da    PI: 5.3879
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015899981.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB160.52.5e-5019112295
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     +eqdr+lPianv+rimkk+lP nakisk+aket+qecvsefisfvtseas kc++e+rkt+ngdd++wal+ lGf++++ pl+ yl +yre+e 
  XP_015899981.1  19 KEQDRLLPIANVGRIMKKILPPNAKISKEAKETMQECVSEFISFVTSEASVKCRKERRKTVNGDDVCWALGALGFDEFAGPLRRYLDRYREIED 112
                     89******************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-4913126IPR009072Histone-fold
SuperFamilySSF471132.9E-3821127IPR009072Histone-fold
PfamPF008088.4E-272488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.5E-155270No hitNo description
PRINTSPR006152.5E-157189No hitNo description
PRINTSPR006152.5E-1590108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MEMEDNIGGE ASNSEGGIKE QDRLLPIANV GRIMKKILPP NAKISKEAKE TMQECVSEFI  60
SFVTSEASVK CRKERRKTVN GDDVCWALGA LGFDEFAGPL RRYLDRYREI EDRPNQEKVS  120
ANNSGSSARL NLPDRLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4218109192Transcription factor HapC (Eurofung)
4g92_B4e-4218109192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015899981.12e-97PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822481e-53NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLB9RT325e-70B9RT32_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0008s22520.11e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.18e-55nuclear factor Y, subunit B5